PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01019566001
Common NameVIT_02s0025g01740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ARF
Protein Properties Length: 683aa    MW: 75680 Da    PI: 6.4768
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01019566001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3764.3e-24117217198
                        EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                        f+kvlt sd++++g +++ +k+a+e+     +++ + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + 
  GSVIVT01019566001 117 FCKVLTASDTSTHGGFSVLRKHANEClpqldMNQATPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RG 206
                        99****************************9555556679************************************************..34 PP

                        SEE..EEEEE- CS
                 B3  88 sefelvvkvfr 98 
                        +++el+v+v+r
  GSVIVT01019566001 207 DNGELRVGVRR 217
                        89999****98 PP

2Auxin_resp99.93.4e-33243322183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+++ ++vGmRfkm+fe+eds+err+sGt+vg +d++p +W++S+WrsLk
  GSVIVT01019566001 243 ASHAVATQTLFIVYYKPRT--SQFIIGLNKYLEAVSNGFAVGMRFKMRFEGEDSPERRFSGTIVGGEDFSP-EWKDSEWRSLK 322
                        789***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.75E-40108246IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-40109232IPR015300DNA-binding pseudobarrel domain
CDDcd100177.07E-21115217No hitNo description
PROSITE profilePS5086312.337117219IPR003340B3 DNA binding domain
PfamPF023624.0E-22117217IPR003340B3 DNA binding domain
SMARTSM010193.5E-22117219IPR003340B3 DNA binding domain
PfamPF065072.1E-30243322IPR010525Auxin response factor
PfamPF023091.9E-10548659IPR033389AUX/IAA domain
SuperFamilySSF542772.26E-12564646No hitNo description
PROSITE profilePS5174527.084570651IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MMVGFGGEGD DLYAELWKAC AGPLVDVPRR GERVFYFPQG HVEQLEASTN QELSQRIPLF  60
NLPSKILCRV IHIQLRAEQE TDEVYAQITL LPEPDQAEPR SPDPCTPEPP RPTVHSFCKV  120
LTASDTSTHG GFSVLRKHAN ECLPQLDMNQ ATPTQELVAK DLHGYEWRFK HIFRGQPRRH  180
LLTTGWSTFV TSKRLVAGDS FVFLRGDNGE LRVGVRRLAR QQSTMPTSVI SSQSMHLGVL  240
ATASHAVATQ TLFIVYYKPR TSQFIIGLNK YLEAVSNGFA VGMRFKMRFE GEDSPERRFS  300
GTIVGGEDFS PEWKDSEWRS LKVQWDEPAS IPRPEKVSPW EIEHYVSSVP QGLAPPGVLK  360
NKRPRSNESP VPETGSAAAS AVWHLGLTQS HDLTQMSSTA EGKRSENHVM WHHKQADIGG  420
PLINSNTACV SRTQTEGSWL SSSHVSASQH QFQDATEDSK SVSAWPALSG YSTLHSSKLT  480
SDTIIDPNGN GKKAVAEMAT SCRLFGFELM NHSSSPPVGK AHGHSISVSS GTDSDQKSDL  540
SKASKEQKQG QSHVSPKEIQ SKQNCYSNTR SRTKVQMQGI AVGRAVDLTA LEGYDELIDE  600
LEEMFEIKGE LRPRYKWEIV FTDDEGDMML VGDDPWPEFC NMVRRIFICS SQDVKKMSPG  660
SKLPISSMEG EGTTISLDST EN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-176634313353Auxin response factor 1
4ldw_A1e-176634313353Auxin response factor 1
4ldv_A1e-176634313353Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.176360.0bud| fruit| inflorescence
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4804970.0AM480497.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X102651.45, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010659520.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLD7TVI50.0D7TVI5_VITVI; Auxin response factor
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9